PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10025403m
Common NameCARUB_v10025403mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 396aa    MW: 44847.8 Da    PI: 5.2701
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10025403mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-172269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed ll+ +v ++G g+W+++ ++ g+ R++k+c++rw ++l
  Carubv10025403m 22 KGPWTQAEDNLLIAYVDKHGDGNWNAVQKHSGLSRCGKSCRLRWVNHL 69
                     79*******************************************996 PP

2Myb_DNA-binding46.96.1e-1575118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+ E+++ ++++++lG++ W++ a +++ gRt++++k++w++
  Carubv10025403m  75 KGAFTEKEEQRVIELHALLGNK-WARMAGELP-GRTDNEIKNFWNT 118
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3711769IPR017930Myb domain
SMARTSM007173.3E-152171IPR001005SANT/Myb domain
SuperFamilySSF466891.31E-2821116IPR009057Homeodomain-like
PfamPF002492.5E-162269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-242376IPR009057Homeodomain-like
CDDcd001672.76E-122469No hitNo description
PROSITE profilePS5129424.96770124IPR017930Myb domain
SMARTSM007174.7E-1474122IPR001005SANT/Myb domain
PfamPF002499.0E-1475118IPR001005SANT/Myb domain
CDDcd001675.39E-1077120No hitNo description
Gene3DG3DSA:1.10.10.605.6E-2477123IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MGKVRNDSGS DEDNATEKAF TKGPWTQAED NLLIAYVDKH GDGNWNAVQK HSGLSRCGKS  60
CRLRWVNHLR PDLKKGAFTE KEEQRVIELH ALLGNKWARM AGELPGRTDN EIKNFWNTRL  120
KRQQRLGLPV YPDEVREQAM NAATQSGFNS DHNSLDGHHS QDSMESDCVE IPQLDFQHLP  180
LNQTSYYHSM LRVVPSSGVF VTQQRPCFFQ PSNMYNLVAS SSPPPYMSTG KRYREPETDD  240
GYAMIEQSTQ LWNYPFVDNI SEQFLDSNDV TYSSPPEPLG PEAKKLELPS FQYYDSHEDH  300
GVVQQQSNSM GEHELLDNNT LVQSSLTDHS PSSSLYDGLL ESVVYGSERK KQVTETELES  360
TLLLQSSLLG HEPKSKLFFS FLTPLHCLCI QFMFA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-31201235107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00279DAPTransfer from AT2G26960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296237.10.0hypothetical protein CARUB_v10025403mg
TrEMBLR0HUP80.0R0HUP8_9BRAS; Uncharacterized protein
STRINGAl_scaffold_0004_9750.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91982138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26960.11e-174myb domain protein 81